SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002465_2.0
Identity
ProteinIodothyronine deiodinase 1 (DIO1)
SpeciesSus scrofa (Pig)
Protein IDSPP00002465
Protein release2.0
External IDNone
Transcript SPT00002457_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002465_2.0 # Protein # Iodothyronine deiodinase 1 (DIO1) # Pig 
MELPLPGLWLKRLWVLFQVALHVAMGKVLMTLFPGRVKQDILAMSQKTGMAKNPHFSHEN
WIPTFFSAQYFWFVLKVRWQRLEDKTEEGGLAPNCPVVSLSGQRCHIWDFMQGNRPLVLN
FGSCTUPSFIFKFDQFKRLIEDFSSIADFLIIYIEEAHASDGWAFKNNVDIKNHQNLQDR
LRAAHLLLDRSPQCPVVVDTMKNQSSRLYAALPERLYVLQAGRILYKGKPGPWNYHPEEV
RAVLEKLHS#
Chart Advanced