SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002428_2.0
Identity
ProteinThioredoxin reductase 2 (TXNRD2)
SpeciesSarcophilus harrisii (Tasmanian devil)
Protein IDSPP00002428
Protein release2.0
External IDNone
Transcript SPT00002420_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002428_2.0 # Protein # Thioredoxin reductase 2 (TXNRD2) # Tasmanian devil 
TGVNEFDLLVIGGGSGGLACAKEAADLGKKVAVMDYVVPSPRGTSWGLGGTCVNVGCIPK
KLMHHSANLGHTLRDAPAYGWQVAPSVPHNWHQMAQGIQNYVKSLNWGHRVQLQERKIKY
FNIQGSFVNEHTVHGVDKSGKEVSRRVEGLRGALGGPGRSDAAGNLPGGAKEYGISSDDL
FWLKESPGKTLVVGASYVSLECAGFLTGFGLDTTVMVRSIPLRGFDQQMALLVTDHMESQ
GTKFLKHCTMKKLEKLQNNQLKVYWNNHEENKECLDVFDTVLWAVGKC
Chart Advanced