SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002309_2.0
Identity
ProteinSelenoprotein O (SELENOO)
SpeciesPteropus vampyrus (Megabat)
Protein IDSPP00002309
Protein release2.0
External IDNone
Transcript SPT00002301_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002309_2.0 # Protein # Selenoprotein O (SELENOO) # Megabat 
MASLKATLGASLAAARTLSPPLGCRPLPALCSASAAARGAAMDPAPRWLAGLRFDNRALR
ELPVETPPPGPEGAPSTPRLVPGACFSRVRPAPLRQPRLVALSEPALALLGLGPPPDDHA
ARDAREAEAALFFSGNALLPGAEPAAHCYCGHQFGQFAGQLGDGAAMYLGEVCTAAGERW
ELQLKGAGPTPFSRQADGRKVLRSSIREFLCSEAMFHLGVPTTRAGACVTSQSTVVRDVF
YDGNPKQEPCAVVLRVAPTFLRFGSFEIFKPADEHTGRAGPSVGRNDIRVQMLDYVVSTF
YPEIQAAHASDSVQRNAAFFREVGGPAPPWPCWVCGPDPPAVGAMQLPPPTWAAPGPGDV
ASAQYDPDHVCNASDNAGRYTYSKQPEVCRWNLRKLAEALEPELPLALAEAILAEEYDAE
FRRHYLHKMRRKLGLVRTEQEEDAALVARLLETMQLTGADFTNTFCLLSSFLVGPEAPGL
DDILTALTTQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALLGSQTNITKELERV
EQQSRLEQLSPAELLSMNKDHWATWLQEYRARLEKDREGAGDAAAWQAERVRTMHASNPK
HVLRNYIAHRAIEAAENGDFSEARACLSLLLLKLLETPYHRDTEAPEVLDATEPEGAGGA
GGEAGGRGSYSSKPPLWAAELCVTUSS
Chart Advanced