SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001293_2.0
Identity
ProteinSelenoprotein M (SELENOM)
SpeciesLoxodonta africana (Elephant)
Protein IDSPP00001293
Protein release2.0
External IDNone
Transcript SPT00001285_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001293_2.0 # Protein # Selenoprotein M (SELENOM) # Elephant 
MRLPLLLPPLLLLLAALGATATTTFRPDWNRLRGLARARVETCGGUQLNRLKEVKAFVTQ
DIPFYHNLVMKHLPGADPELVLLGHRYEELERIPLSDMTREEINALVQELGFYRKAAPDA
PVPPEYLQAPARPAESATDHGDL
Chart Advanced