SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000647_2.0
Identity
ProteinMethionine-R-sufoxide reductase 3 (MSRB3)
SpeciesDanio rerio (Zebrafish)
Protein IDSPP00000647
Protein release2.0
External IDNone
Transcript SPT00000639_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000647_2.0 # Protein # Methionine-R-sufoxide reductase 3 (MSRB3) # Zebrafish 
MSGFNLLHLVSQGQPVKLKACGLPSGTCRSKKTWPKTFPEEELRKRLTPMQYHVTQQKGT
ESAFTGKYVDNKEEGTYHCVVCGAPLFMSEKKFDSGSGWPSFFDLINKDAIAQTDDFSYG
MHRVETTCSQCGAHLGHLFDDGPRPTKKRYCINSASLSFQPKNSATEEVEASGAAGQSST
SKNEEL#
Chart Advanced