SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000579_2.0
Identity
ProteinIodothyronine deiodinase (DIO)
SpeciesCiona savignyi (Sea Squirt)
Protein IDSPP00000579
Protein release2.0
External IDNone
Transcript SPT00000571_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000579_2.0 # Protein # Iodothyronine deiodinase  (DIO) # Sea Squirt 
GKPVPNVKLYSLEDDPRECKIMDFVKGNRPLVINFGSCSUPPFEKYSNEVDFLVIYIREA
HPINGWSFANNKYQIYDHKSLEERISAARIFADDAQVKCPVVVDNMNDEAAVQYAALPER
LYILQDNLIKYDGARGSFGYNLSEMEDSLKNCLQKV
Chart Advanced