SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000558_2.0
Identity
ProteinSECIS binding protein 2 (SBP2)
SpeciesCiona intestinalis (Sea Squirt)
Protein IDSPP00000558
Protein release2.0
External IDNone
Transcript SPT00000550_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000558_2.0 # Protein # SECIS binding protein 2 (SBP2) # Sea Squirt 
PANALDSTAPLIKKGKEREVPKPKKPSALKKVILKEREEKKEHHLKQLTTMLSPETDVPP
YPPALYKIPVPSDDEKSLGHDTNTEVSVSIPPTVPQIHSRRYREYCCQVLDKRVDEMSNQ
MLQRLVYFQDRLYKTDPAKAKRKRRVVLGFREVTKHLKMKKLRCVIISPNLEKIESKGGL
DDVLHEILDLCKEQNIPYVFALGKKALGRAVSKTVPVSIVGVFDYSGAEVTF
Chart Advanced