SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000244_2.0
Identity
ProteinGlutathione peroxidase 7 (GPx7)
SpeciesBos taurus (Cow)
Protein IDSPP00000244
Protein release2.0
External IDNone
Transcript SPT00000236_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000244_2.0 # Protein # Glutathione peroxidase 7 (GPx7) # Cow 
FAAQVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIES
FARRTYSVSFPMFSKIAVTGTGAHPAFKYLTGESPSTWNFWKYLVAPDGKVIGAWDPTVS
VEEIRPQITALVRKL
Chart Advanced