SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000009_2.0
Identity
ProteinIodothyronine deiodinase 2 (DIO2)
SpeciesHomo sapiens (Human)
Protein IDSPP00000009
Protein release2.0
External IDNone
Transcript SPT00000009_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox SNP (Present-day Humans) SNP (Neandertals)  
Sequence
>SPP00000009_2.0 # Protein # Iodothyronine deiodinase 2 (DIO2) # Human 
MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGL
RCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASP
ERPLVVNFGSATUPPFTSQLPAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSF
EVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAY
LGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG#
Chart Advanced