SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00003181_2.0
Identity
ProteinSelenoprotein S (SELENOS)
SpeciesHomo sapiens ssp. Denisova (Denisovan)
Protein IDSPP00003181
Protein release2.0
External IDNone
Transcript SPT00003189_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox SNP (Present-day Humans)  
Sequence
>SPP00003181_2.0 # Protein # Selenoprotein S (SELENOS) # Denisovan 
MMGGSSAAAPGAGAWEAWERSGVGAYADLGQQARTLRGGFSGAALPWAARLSLVCASLFC
EPSPSLGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQE
ALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPG
Chart Advanced