SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002654_2.0
Identity
ProteinIodothyronine deiodinase 3b (DIO3b)
SpeciesTetraodon nigroviridis (Tetraodon)
Protein IDSPP00002654
Protein release2.0
External IDNone
Transcript SPT00002646_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002654_2.0 # Protein # Iodothyronine deiodinase 3b (DIO3b) # Tetraodon 
MMNTMKSIKNALVFFVLLPRFLMAAVMFWLLDFLCIRKRVFFRMKEQEDDAVDPPLCISD
SNRLFTVESLKAVWHGHKLDFLKAAHLGQGAPNTEVVQLEDQRRSRILDYAKDKRPLILN
FGSCTUPPFMARLKAFQGVVEQNADIADTVVVYIEEAHPSDGWVSTDAPYQIPKHRCLED
RLSAAQLMRLEVPGCLVVVDSMENSSNAAYGAYFDRLYILQEGKIVYQGGRGPEGYRITE
LRDWLEKYRKSLETSNNLVIHL
Chart Advanced