SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002538_2.0
Identity
ProteinSelenoprotein N (SELENON)
SpeciesTaeniopygia guttata (Zebra Finch)
Protein IDSPP00002538
Protein release2.0
External IDNone
Transcript SPT00002530_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002538_2.0 # Protein # Selenoprotein N (SELENON) # Zebra Finch 
PGAAPPRLALALALLAVLLAIKYYRDAEAARQQELALKSLGNEGLFLFSSLDTNKDLYLS
PEEFKPIAEKLTGVPAVSESEEEETPDPDGETLSIVAKFQPLLMETMTKSKDGFLGISHV
ALSGLRNWTAPAAPMSVLLARQFKAFLPPKDNLDLGDPWWIIPSELNIFTGYLSNNRFYP
PPPKGKEVIIHKLLSMFHPRPFVRTRFAPQGAVACIQASSSFYYTIAFRIHAEFQLNEPP
NFPFWFSPGQFTGYIVLSKDSSHIRDFRLFVPNNRSLNVDMEWLYGASESSNMEVDIGYL
PQMELESTGPSVPTVIHDENGNVLDSRDPSGEPIQFVFEEITWQQEIPWQEAAHRLEVAM
YPFKKISYLPFTEAFERAQAEKKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILALL
NESFISSWSLVKELEELQSNRENEFYSKLAKLHLEKYNFPVEMIICLPNGTVIHHINANY
FLDITSMKPEDVESSIFSFSTNFEDPSTATYLQFLKEGLHRAKPYLQP
Chart Advanced