SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002518_2.0
Identity
ProteinIodothyronine deiodinase (DIO)
SpeciesTaeniopygia guttata (Zebra Finch)
Protein IDSPP00002518
Protein release2.0
External IDNone
Transcript SPT00002510_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002518_2.0 # Protein # Iodothyronine deiodinase  (DIO) # Zebra Finch 
MSGIRVVLQKILILLQVSLSVVVGKTLMILFPNAMKRYILKMGEKSRMNQNPKFSYENWG
PTFFSFKYLQFVLKVKWKRLEDEAYEGHPAPNTPVVTLGGEVCHLLDFMKDNRPLILNFG
SCTUPSFMLKFDEFNKLIKDFSSIADFLIIYIEEAHAVDGWAFKNNVIIKNHRSLEDRKI
AAQFLQKSHPLCPVVLDTMENLSSSKYAALPERLYVLQGGKVIYR
Chart Advanced