SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002243_2.0
Identity
ProteinGlutathione peroxidase 3 (GPx3)
SpeciesProcavia capensis (Hyrax)
Protein IDSPP00002243
Protein release2.0
External IDNone
Transcript SPT00002235_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002243_2.0 # Protein # Glutathione peroxidase 3 (GPx3) # Hyrax 
FQTDCHGGMSGTIYDYGALTIDGEEYIPFKQYAGKYILFVNVATYUGLTGQYVELNALQD
ELAPFGLVILGFPCNQFGKQEPGENSEILATLKYVRPGGGFVPNFQLFEKGDVNGEKEQK
FYTFLKNSCPPTSELVGSPDRLFWDPMKIHDVRWNFEKFLVGPNGVPVMRWYHRTPVNTV
KLDILNYMKQ
Chart Advanced