SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002188_2.0
Identity
ProteinIodothyronine deiodinase 3 (DIO3)
SpeciesPongo abelii (Orangutan)
Protein IDSPP00002188
Protein release2.0
External IDNone
Transcript SPT00002180_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002188_2.0 # Protein # Iodothyronine deiodinase 3 (DIO3) # Orangutan 
GEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHF
LGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHE
GGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQSDV
DFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSS
SAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQL
Chart Advanced