SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001977_2.0
Identity
Protein15 kDa selenoprotein (Sel15)
SpeciesOryzias latipes (Medaka)
Protein IDSPP00001977
Protein release2.0
External IDNone
Transcript SPT00001969_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001977_2.0 # Protein # 15 kDa selenoprotein (Sel15) # Medaka 
LTPTLLQTLLSCGAELSSEACRDLGFSSNLLCSSCDLLGEFSLTKLQPDCGRCCQQEAQM
EGRKLYPGAILEVCGUKLGRFPQVQAFVRSEKPKIFKGLQIKYVRGSDPVLKLLDDNGNI
AEELSILKWNTDSVEEFLGEKLERI#
Chart Advanced