SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001908_2.0
Identity
ProteinIodothyronine deiodinase (DIO)
SpeciesOryctolagus cuniculus (Rabbit)
Protein IDSPP00001908
Protein release2.0
External IDNone
Transcript SPT00001900_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001908_2.0 # Protein # Iodothyronine deiodinase  (DIO) # Rabbit 
SGSCTUTAVHGAHEAPSGRLVAKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLE
DRVRAARV
Chart Advanced