SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001770_2.0
Identity
ProteinSelenoprotein I (SELENOI)
SpeciesOchotona princeps (Pika)
Protein IDSPP00001770
Protein release2.0
External IDNone
Transcript SPT00001762_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001770_2.0 # Protein # Selenoprotein I (SELENOI) # Pika 
LICFCRSYKNNTLKHNSVYEAMIPFFSPCLLFILSTVWILRSPSDILELHPRIFYFMVGT
AFANITCQLIVCQMSSTRCPTLNWLLIPLFLVVMAVNLGVASHIESILLYTLTTTFTLAH
IHYGVRVVKQLSSHFQIYPFSLRKPNSDULGMEAKNIVV
Chart Advanced