SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001572_2.0
Identity
ProteinSelenoprotein K (SELENOK)
SpeciesMus musculus (Mouse)
Protein IDSPP00001572
Protein release2.0
External IDNone
Transcript SPT00001564_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001572_2.0 # Protein # Selenoprotein K (SELENOK) # Mouse 
MVYILNGQVLDSINQSLWRVSFLTDFWGIAEFVVFCFKTLLRQDVKKRRGYGSSSDSRYD
DRRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR
Chart Advanced