SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001485_2.0
Identity
ProteinSelenoprotein R (MSRB)
SpeciesMicrocebus murinus (Mouse Lemur)
Protein IDSPP00001485
Protein release2.0
External IDNone
Transcript SPT00001477_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001485_2.0 # Protein # Selenoprotein R  (MSRB) # Mouse Lemur 
MSFCSFFGGEVFQNHFEPGIYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPE
FNRPEALKVSCGRCGNGLGHEFLNDGPKRGQSRFUIFSSSLKFIPKGKETSASQGH%
Chart Advanced