SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001123_2.0
Identity
ProteinIodothyronine deiodinase 1 (DIO1)
SpeciesGorilla gorilla (Gorilla)
Protein IDSPP00001123
Protein release2.0
External IDNone
Transcript SPT00001115_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001123_2.0 # Protein # Iodothyronine deiodinase 1 (DIO1) # Gorilla 
MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDN
WIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLN
FGSCTUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDR
LQAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYVIQEGRILYKGKSGPWNYNPEEV
RAVLEKLHS
Chart Advanced