SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001049_2.0
Identity
ProteinSelenoprotein N (SELENON)
SpeciesGallus gallus (Chicken)
Protein IDSPP00001049
Protein release2.0
External IDNone
Transcript SPT00001041_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001049_2.0 # Protein # Selenoprotein N (SELENON) # Chicken 
MAVPGAAPSRLALALAALAALAAVKYYRDAEAARQQELALKSLGSEGLFLFSSLDTNNDL
YLSPEEFKPIAEKLTGVTPVSDFEEDAPDPNGETLSIVAKFQPLVMETMTKSKDGFLGIS
HVALSGLRNWTAPVSPKSVMLARQFKAFLPPKNKLDLGDPWWIIPSELNIFTGYLSNNRF
YPPPPKGKEIIIHRLLSMFHPRPFVKTRFAPQGSVACIQAISTYYYTIAFRIHAEFQLNE
PPDFPFWFSPGQFTGYIVLSKDSSHVREFKLFVPNKRSLNVDMEWLYGASEGSNMEVDIG
YLPQMELESTGPSVPSVIYDENGNVIDSRDPSGEPIQFVFEEITWQQEIPWEEAAQKLEV
AMYPFKKVSYLPFTEAFERAKAEKKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILA
LLNESFISSWSLVKELEELQTNRENEFYSKLADLHLEKYNFPVEMIICLPNGTVIHHINA
NYFLDITSMKPEDVESSIFSFSANFDDPSTATYLQFLKEGLQRAKAYLQN#
Chart Advanced