SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000984_2.0
Identity
ProteinGlutathione peroxidase 3b (GPx3b)
SpeciesGadus morhua (Cod)
Protein IDSPP00000984
Protein release2.0
External IDNone
Transcript SPT00000976_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000984_2.0 # Protein # Glutathione peroxidase 3b (GPx3b) # Cod 
SIYDFMAESLDGQSVPLSKYRGKVLLIVNLATFUGSTIEEHHRLNALMDMFGGLHFTVLG
FCCNQFGLQSPGKEVNSETLNILKYVRPGGGFIPKFPVFGKVEVNGLSEEPLFTYLKDSL
PFVNPVIGDIKKFYWSPIRVNDIRWNFERFLITADGVPFRR#
Chart Advanced