SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000894_2.0
Identity
ProteinIodothyronine deiodinase 2 (DIO2)
SpeciesErinaceus europaeus (Hedgehog)
Protein IDSPP00000894
Protein release2.0
External IDNone
Transcript SPT00000886_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000894_2.0 # Protein # Iodothyronine deiodinase 2 (DIO2) # Hedgehog 
LLLFLCPQVKLGENAPNSSVVHVSKPEAGDNTGRGAQDKMVDGAECHLLDFASPERPLVV
NFGSATUPPFTSQLPTFSKLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSLSLDVRKHR
SQEDRCAAAHQLLERFSLPPQCRVVADRMDNNANVAYGVAFERVCIVQRQKIAYLGGKGP
FCYNLQEVRHWLEKSFSQR
Chart Advanced