SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000757_2.0
Identity
ProteinGlutathione peroxidase (GPx)
SpeciesDrosophila melanogaster (Fruitfly)
Protein IDSPP00000757
Protein release2.0
External IDNone
Transcript SPT00000749_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000757_2.0 # Protein # Glutathione peroxidase (GPx) # Fruitfly 
KNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGL
VILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTG
TLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL
Chart Advanced