SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000652_2.0
Identity
ProteinSelenoprotein U1a (SELENOU1a)
SpeciesDanio rerio (Zebrafish)
Protein IDSPP00000652
Protein release2.0
External IDNone
Transcript SPT00000644_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000652_2.0 # Protein # Selenoprotein U1a (SELENOU1a) # Zebrafish 
GNNFLKIFEGETLAMGMWSLGLGAVGAAIAGLILANTDFLLTKSAPATVDYLANADLKTI
DGDERSLKAKALWEKSGAVIMAVRRPGUFLCREEASELSSLKPQLDELGVPLYAVVKENV
GTEIQDFRPHFAGEIFLDEKQAFYGPQQRKMGGLGFIRLGVWQNFVRAWRAGYQGNMNGE
GFILGGVFVMGSGGQGVLLEHREKEFGDKVSLESVLEAAKKV
Chart Advanced