SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000621_2.0
Identity
ProteinGlutathione peroxidase 1a (GPx1a)
SpeciesDanio rerio (Zebrafish)
Protein IDSPP00000621
Protein release2.0
External IDNone
Transcript SPT00000613_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000621_2.0 # Protein # Glutathione peroxidase 1a (GPx1a) # Zebrafish 
MAGIKSFYDITAKTLTGEEFKFSSLQGKVVLIENVASLUGTTSRDYTQMNELHERFAEKG
LVVLGVPCNQFGYQENCTNEEILLSLKYVRPGNGYEPKFQLLEKVDVNGKNAHPLFTFLK
EKLPFPSDEPMPFMSDPKFIIWSPVCRNDIAWNFEKFLIGSDGVPFKRYSRRFLTSGIDG
DIKKLLSIPK
Chart Advanced