SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000467_2.0
Identity
ProteinMethionine-R-sufoxide reductase 2 (MSRB2)
SpeciesCavia porcellus (Guinea Pig)
Protein IDSPP00000467
Protein release2.0
External IDNone
Transcript SPT00000459_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000467_2.0 # Protein # Methionine-R-sufoxide reductase 2 (MSRB2) # Guinea Pig 
LFNNTESLTKDERTLTKAEWQKKLTPEQFYVTREKGTEPPFSGIYLNTKEPGMYHCVCCD
SPLFSSEKKFCSGTGWPSFSEAHGALGSDESHSGILRRLDTSSGSARTEVICKQCEAHLG
HVFPDGPGPSGQRFCINSVALKFKPS
Chart Advanced