SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000309_2.0
Identity
ProteinIodothyronine deiodinase 1 (DIO1)
SpeciesCallithrix jacchus (Marmoset)
Protein IDSPP00000309
Protein release2.0
External IDNone
Transcript SPT00000301_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000309_2.0 # Protein # Iodothyronine deiodinase 1 (DIO1) # Marmoset 
MGLPGPGLWLKRLWVLLEVAVHVAVGKVLLTLFPDRVKKNILAMGDKTGMTRNPNFSHDN
WIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVHLSGQRCNIWDFMQGNRPLVLN
FGSCTUPSFMFKFDQFKRLTEDFSSVADFLIIYIEEAHASDGWAFKNNVDIRNHQNLQDR
LQAAHLLLARSPQCPVVVDTMQNQSSELYAALPERLYIIQEGRILYKGKSGPWNYNPEEV
RDVLEKLHS
Chart Advanced